Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Uniprot NO.:B5YGC8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRKFFVILMVALVVVLTASAVFAADSDPAKLNYYGYATAGALIGLGAAAGGGGAGMGQGL RGILEGSARNPGVTGKLMTLFIVGLALIESLVIYVLVFVLITFYANPFVK
Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Gene Names:Name:atpE Ordered Locus Names:THEYE_A1529
Expression Region:1-110
Sequence Info:full length protein