Gene Bio Systems
Recombinant Thermococcus onnurineus UPF0290 protein TON_1624 (TON_1624)
Recombinant Thermococcus onnurineus UPF0290 protein TON_1624 (TON_1624)
SKU:CSB-CF476092TMR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thermococcus onnurineus (strain NA1)
Uniprot NO.:B6YUC9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLSSLLWAFWYILPAYFANASPVLVGGGRPIDGGRYWKDGRRVFGDGKTWRGLIGGVAI GTAVGALQYFITPEFYGSLGKALLLAFLLSFGALFGDLVGSFFKRRIDLPRGSPAIGLDQ LGFLISALAFAYPVKTLDSGQIIFLLVVSPFVHWGANYFAYKMGWKSVPW
Protein Names:Recommended name: UPF0290 protein TON_1624
Gene Names:Ordered Locus Names:TON_1624
Expression Region:1-170
Sequence Info:full length protein
