Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermanaerovibrio acidaminovorans Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

Recombinant Thermanaerovibrio acidaminovorans Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

SKU:CSB-CF511411TMH

Regular price £1,331.00 GBP
Regular price Sale price £1,331.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thermanaerovibrio acidaminovorans (strain ATCC 49978 / DSM 6589 / Su883) (Selenomonas acidaminovorans)

Uniprot NO.:D1B5U2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSISEKVTLGQYVPADSPVHSLDPRTKILSTLVLLFALFGVRDPRFFLGWGVLLAFIVFL SRVSLRTVLRSVRPVLWLLVFTVLLHALFTPGEAILRFHFIKVSREGLHMAALMGVRLVL LVAFAGLLTLTTSPMELADGMESLMSPLARVRFPAHEMAMMMTIALRFIPTLLEETDRIL KAQISRGADLEGGGVVKRLRAFVPVLVPLFLIVFQRAEDLALAMESRCYVGGVGRTRMRP LRWCLEDWVALGLMSVSVAGLLFLERAVG

Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein EcfT Short name= ECF transporter T component EcfT

Gene Names:Name:ecfT Ordered Locus Names:Taci_1151

Expression Region:1-269

Sequence Info:full length protein

View full details