Skip to product information
1 of 1

Gene Bio Systems

Recombinant Synechocystis sp. UPF0093 membrane protein slr1790 (slr1790)

Recombinant Synechocystis sp. UPF0093 membrane protein slr1790 (slr1790)

SKU:CSB-CF302618SSQ

Regular price £1,304.00 GBP
Regular price Sale price £1,304.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechocystis sp. (strain PCC 6803 / Kazusa)

Uniprot NO.:P72793

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKREYFSLPCPLSTFTMAYYWFKAFHLIGIVVWFAGLFYLVRLFVYHAEADQEPEPAKT ILKKQYELMEKRLYNIITTPGMVVTVAMAIGLIFTEPEILKSGWLHIKLTFVALLLLYHF YCGRVMKKLAQGESQWSGQQFRALNEAPTILLVVIVLLAVFKNNLPLDATTWLIVALVIA MAASIQLYAKKRRRDQALLTEQQKAASAQN

Protein Names:Recommended name: UPF0093 membrane protein slr1790

Gene Names:Ordered Locus Names:slr1790

Expression Region:1-210

Sequence Info:full length protein

View full details