Gene Bio Systems
Recombinant Synechococcus sp. ATP synthase subunit c(atpE)
Recombinant Synechococcus sp. ATP synthase subunit c(atpE)
SKU:CSB-CF646392SSG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime)
Uniprot NO.:Q2JIF6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDPLTSAASVLSAALAIGLGSLGPGLGQGNAAAAAMEGLARQPEAEDKIRGNLLVSLAFM EALTIYGLVVALVLLFANPFA
Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Gene Names:Name:atpE Synonyms:atpH Ordered Locus Names:CYB_2677
Expression Region:1-81
Sequence Info:full length protein
