Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfolobus solfataricus UPF0290 protein SSO0776(SSO0776)

Recombinant Sulfolobus solfataricus UPF0290 protein SSO0776(SSO0776)

SKU:CSB-CF892608FPM

Regular price £1,237.00 GBP
Regular price Sale price £1,237.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

Uniprot NO.:Q9UXG3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIAYDLLLSILIYLPAFVANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW

Protein Names:Recommended name: UPF0290 protein SSO0776

Gene Names:Ordered Locus Names:SSO0776 ORF Names:C40_012

Expression Region:1-166

Sequence Info:full length protein

View full details