Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfolobus islandicus filamentous virus Uncharacterized protein 52(SIFV0052)

Recombinant Sulfolobus islandicus filamentous virus Uncharacterized protein 52(SIFV0052)

SKU:CSB-CF835504SUY

Regular price £1,160.00 GBP
Regular price Sale price £1,160.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) (SIFV)

Uniprot NO.:Q914I0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSCSYEFIVDVNVCSTTYNRRYFHKFQLHSLVNTNVNVNKKYAYPSAGVDIVAVATTLPF IVAVICIVFDEVNVF

Protein Names:Recommended name: Uncharacterized protein 52

Gene Names:Name:SIFV0052

Expression Region:1-75

Sequence Info:full length protein

View full details