Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfolobus acidocaldarius Protoheme IX farnesyltransferase(ctaB)

Recombinant Sulfolobus acidocaldarius Protoheme IX farnesyltransferase(ctaB)

SKU:CSB-CF676868FOZ

Regular price £1,345.00 GBP
Regular price Sale price £1,345.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

Uniprot NO.:Q4J8E4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVTLSRKLIDYVKLAKPKVVSLLDVVAIASYILAFKGNWYNLIPVLIGGSIAAGGSMII NGGLEIEKDKVMKRTSWRPTVKGEVGRKEAYMVGGIACALGSLIGLLANPLTAFFILLGS LVYVFVYSYYLKPRTWLNIVIGGFAGSAAAWAGYAAASNSFNLESLLLGLLVFAWTPGHF WALALRYKRDYANAEIPMLPAIVDDKTAARAIAISNILMIPFALGLMLYLNLIYVIITLA ATAVLLYFNVRLMRNPTPEESWISYKFSAPYLAIVMIAAVISFIL

Protein Names:Recommended name: Protoheme IX farnesyltransferase EC= 2.5.1.- Alternative name(s): Heme B farnesyltransferase Heme O synthase

Gene Names:Name:ctaB Ordered Locus Names:Saci_1635

Expression Region:1-285

Sequence Info:full length protein

View full details