Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfolobus acidocaldarius Membrane-associated ATPase C chain(atpP)

Recombinant Sulfolobus acidocaldarius Membrane-associated ATPase C chain(atpP)

SKU:CSB-CF678020FOZ

Regular price £1,182.00 GBP
Regular price Sale price £1,182.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

Uniprot NO.:Q4J8L5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRKALLISLILPILIGGLVAAAQAPQDTPQGFMGINIGAGLAVGLAAIGAGVAVGTAAAA GIGVLTEKREMFGTVLIFVAIGEGIAVYGIIFAVLMLFAGI

Protein Names:Recommended name: Membrane-associated ATPase C chain

Gene Names:Name:atpP Ordered Locus Names:Saci_1552

Expression Region:1-101

Sequence Info:full length protein

View full details