Gene Bio Systems
Recombinant Succinate dehydrogenase cytochrome b556 subunit(sdhC)
Recombinant Succinate dehydrogenase cytochrome b556 subunit(sdhC)
SKU:CSB-CF701563PBZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Paracoccus denitrificans
Uniprot NO.:Q59659
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADVNRGNRPLSPHLQVYRLPLAAITSIMTRITGHALVAGIVLITWWLVAAVTSPGAFAC ADWVVRSWLGFIILTGSMWALWYHLLAGLRHLFYDAGYGLEIEQAHKSSQALIAGSVVLA VLTLIVFFVF
Protein Names:Recommended name: Succinate dehydrogenase cytochrome b556 subunit Short name= Cytochrome b-556
Gene Names:Name:sdhC
Expression Region:1-130
Sequence Info:full length protein
