Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase(pat)

Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase(pat)

SKU:CSB-YP701139FOQ

Regular price £959.00 GBP
Regular price Sale price £959.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Streptomyces viridochromogenes

Uniprot ID: Q57146

Gene Names: pat

Organism: Streptomyces viridochromogenes

AA Sequence: MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI

Expression Region: 1-183aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 22.6 kDa

Alternative Name(s): PPT N-acetyltransferase;Phosphinothricin-resistance protein

Relevance: Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.

Reference: "Cloning of a phosphinothricin N-acetyltransferase gene from Streptomyces viridochromogenes Tue494 and its expression in Streptomyces lividans and Escherichia coli."Strauch E., Wohlleben W., Puehler A.Gene 63:65-74(1988).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details