Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A

Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A

SKU:CSB-EP365519SQB

Regular price £798.00 GBP
Regular price Sale price £798.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P01092

Gene Names: N/A

Organism: Streptomyces tendae

AA Sequence: DTTVSEPAPSCVTLYQSWRYSQADNGCAQTVTVKVVYEDDTEGLCYAVAPGQITTVGDGYIGSHGHARYLARCL

Expression Region: 31-104aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 28 kDa

Alternative Name(s): Tendamistat

Relevance: Inhibits mammalian alpha-amylases specifically but has no action on plant and microbial alpha-amylases. Forms a tight stoichiometric 1:1 complex with alpha-amylase.

Reference: "Tendamistat (HOE 467), a tight-binding alpha-amylase inhibitor from Streptomyces tendae 4158. Isolation, biochemical properties." Vertesy L., Oeding V., Bender R., Zepf K., Nesemann G. Eur. J. Biochem. 141:505-512(1984)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details