Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptomyces coelicolor Lipoprotein signal peptidase(lspA)

Recombinant Streptomyces coelicolor Lipoprotein signal peptidase(lspA)

SKU:CSB-CF865800FOB

Regular price £1,275.00 GBP
Regular price Sale price £1,275.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

Uniprot NO.:Q9S2X7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEAERIIGTPDIPDAAGEGQERPDADPEREQQEQEQAPERTRGKRRVAVLFAVALFAYL LDLGSKMLVVAKLEHHEPIEIIGDWLRFAAIRNAGAAFGFGEAFTIIFTVIAAAVIVVIA RLARKLHSLPWAIALGLLLGGALGNLTDRIFRAPGVFEGAVVDFIAPKHFAVFNLADSAI VCGGILIVILSFRGLDPDGTVHKD

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA Ordered Locus Names:SCO2074 ORF Names:SC4A10.07c

Expression Region:1-204

Sequence Info:full length protein

View full details