Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus suis UPF0397 protein SSU98_0390 (SSU98_0390)

Recombinant Streptococcus suis UPF0397 protein SSU98_0390 (SSU98_0390)

SKU:CSB-CF394303SUT

Regular price £1,250.00 GBP
Regular price Sale price £1,250.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus suis (strain 98HAH33)

Uniprot NO.:A4VZK9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKNNSIKTVVATGIGAALFVVIGHLINIPTFVPNTSIQLQYAVQSLLAVVFGPVVGFLVG FIGHTLKDSLTYGPWWSWILASGVFGLVVGLTKKRLRIQEGIFEGKDILFFNLVQIAANV LAWGVIAPVLDILIYSEAANKVFAQGLVAGIANSITIAIAGTLLLVVYAKSQTKTGSLSK D

Protein Names:Recommended name: UPF0397 protein SSU98_0390

Gene Names:Ordered Locus Names:SSU98_0390

Expression Region:1-181

Sequence Info:full length protein

View full details