Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus pyogenes serotype M3 Uncharacterized membrane protein SPs1599 (SPs1599)

Recombinant Streptococcus pyogenes serotype M3 Uncharacterized membrane protein SPs1599 (SPs1599)

SKU:CSB-CF316281SMW

Regular price £1,291.00 GBP
Regular price Sale price £1,291.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus pyogenes serotype M3 (strain SSI-1)

Uniprot NO.:P0DA11

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRENLISILVNQPMIYYG AAIIELILVFVASGAARKNTPAALPIFLIYAALNGFTLSFIIVAYAQTTVFQAFLSSAAV FFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISVLIFSGLI ASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLLRIFGRND

Protein Names:Recommended name: Uncharacterized membrane protein SPs1599

Gene Names:Ordered Locus Names:SPs1599

Expression Region:1-229

Sequence Info:full length protein

View full details