Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus pneumoniae UPF0397 protein SP70585_0545 (SP70585_0545)

Recombinant Streptococcus pneumoniae UPF0397 protein SP70585_0545 (SP70585_0545)

SKU:CSB-CF508133FMX

Regular price £1,252.00 GBP
Regular price Sale price £1,252.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus pneumoniae (strain 70585)

Uniprot NO.:C1C5K9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVG LIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINSVFDWKDILIFNLIQLLAN ALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGTLLLLAYAGTQTRAGSLK KD

Protein Names:Recommended name: UPF0397 protein SP70585_0545

Gene Names:Ordered Locus Names:SP70585_0545

Expression Region:1-182

Sequence Info:full length protein

View full details