Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 1(yidC1)

Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 1(yidC1)

SKU:CSB-CF812182SMP

Regular price £1,340.00 GBP
Regular price Sale price £1,340.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Uniprot NO.:Q8DNE1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CVNVDKTTGQPTGFIWNTIGAPMAEAIKYFATDKGLGFGVAIIIVTIIVRLIILPLGIYQ SWKATLHSEKMNALKHVLEPHQTRLKEATTQEEKLEAQQALFAAQKEHGISMFGGVGCFP ILLQMPFFSAIYFAAQHTEGVAQASYLGIPLGSPSMILVACAGVLYYLQSLLSLHGVEDE MQREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFMMILQQFIVNYIVRPKLRKKVHE ELAKNPSKASAFSTPSGRKDVTPEQPTAITSKKKHKNRNAGKQRSR

Protein Names:Recommended name: Membrane protein insertase YidC 1 Alternative name(s): Foldase YidC 1 Membrane integrase YidC 1 Membrane protein YidC 1

Gene Names:Name:yidC1 Ordered Locus Names:spr1790

Expression Region:23-308

Sequence Info:full length protein

View full details