Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus gordonii UPF0397 protein SGO_0469 (SGO_0469)

Recombinant Streptococcus gordonii UPF0397 protein SGO_0469 (SGO_0469)

SKU:CSB-CF419756FMN

Regular price £1,254.00 GBP
Regular price Sale price £1,254.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288)

Uniprot NO.:A8AVH5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKIFDTTFTIKEVVATGIGAALFVVIGMVSIPTPVPNTSIQLQYAVQALFGVVFGPIVG FLTGFIGHALKDSIQYGNPWWTWVLASGLFGLVVGLLKNYLRVAQGVFESRDIITFNVAQ FVANALVWVVIAPLGDILIYNEPSNKVFAQGVVATVANGLTVAVAGTLLLIAYARTQTKS GSLKKD

Protein Names:Recommended name: UPF0397 protein SGO_0469

Gene Names:Ordered Locus Names:SGO_0469

Expression Region:1-186

Sequence Info:full length protein

View full details