Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0316 protein SSP0880(SSP0880)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0316 protein SSP0880(SSP0880)

SKU:CSB-CF674415SBAG

Regular price £1,261.00 GBP
Regular price Sale price £1,261.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Uniprot NO.:Q49YV5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVITSNPWLMVLAIFIINVAYVTCLTMRTILTLKGYRYVAAIVSFLEVLVYVVGLGMVM SSLDQIQNVFAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSSEYELDLPRQLRDLGYGVT HNTAYGRDGKRLILQILTPRRFEFKLIDTIKQIDEKAFIVAYEPRQIHGGFWAKGVRSKK LKQYDTDEVESI

Protein Names:Recommended name: UPF0316 protein SSP0880

Gene Names:Ordered Locus Names:SSP0880

Expression Region:1-192

Sequence Info:full length protein

View full details