Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557(SERP0557)

Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557(SERP0557)

SKU:CSB-CF683217SAAA

Regular price £1,208.00 GBP
Regular price Sale price £1,208.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Uniprot NO.:Q5HQJ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLHVHILSWVLAIILFIATYLNYSKTQGASPYYKPLHMALRLFMLLTLISGFWELIEEFM AASNGEGGNHMLLTLKMLCGLAVIAFMEISIAKRKKQQTSHKFFWITIILIIITMAIGVI LPWGPISKIFGIS

Protein Names:Recommended name: UPF0344 protein SERP0557

Gene Names:Ordered Locus Names:SERP0557

Expression Region:1-133

Sequence Info:full length protein

View full details