Gene Bio Systems
Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557(SERP0557)
Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557(SERP0557)
SKU:CSB-CF683217SAAA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Uniprot NO.:Q5HQJ2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLHVHILSWVLAIILFIATYLNYSKTQGASPYYKPLHMALRLFMLLTLISGFWELIEEFM AASNGEGGNHMLLTLKMLCGLAVIAFMEISIAKRKKQQTSHKFFWITIILIIITMAIGVI LPWGPISKIFGIS
Protein Names:Recommended name: UPF0344 protein SERP0557
Gene Names:Ordered Locus Names:SERP0557
Expression Region:1-133
Sequence Info:full length protein
