Gene Bio Systems
Recombinant Staphylococcus carnosus UPF0344 protein Sca_0577 (Sca_0577)
Recombinant Staphylococcus carnosus UPF0344 protein Sca_0577 (Sca_0577)
SKU:CSB-CF494229FLK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus carnosus (strain TM300)
Uniprot NO.:B9DIS4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLHLHIFSWVIGIILFIVSYISFTKTGAPKKAYKPLHMTLRLFLVLILFSGVWQVVEEFA TATGSTHMLLTLKMICGIGVVALMEVTLVRKQRGASHKGLFWGTIALIIVTMALGIILPG GPISNMFVITK
Protein Names:Recommended name: UPF0344 protein Sca_0577
Gene Names:Ordered Locus Names:Sca_0577
Expression Region:1-131
Sequence Info:full length protein
