Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus carnosus ATP synthase subunit c(atpE)

Recombinant Staphylococcus carnosus ATP synthase subunit c(atpE)

SKU:CSB-CF494963FLK

Regular price £1,180.00 GBP
Regular price Sale price £1,180.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus carnosus (strain TM300)

Uniprot NO.:B9DME9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMSIMFIGIGLVEALPILG LVISFIVLFQ

Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpE Ordered Locus Names:Sca_1612

Expression Region:1-70

Sequence Info:full length protein

View full details