Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0316 protein MW1852 (MW1852)

Recombinant Staphylococcus aureus UPF0316 protein MW1852 (MW1852)

SKU:CSB-CF351640SUL

Regular price £1,287.00 GBP
Regular price Sale price £1,287.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain MW2)

Uniprot NO.:P61545

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK

Protein Names:Recommended name: UPF0316 protein MW1852

Gene Names:Ordered Locus Names:MW1852

Expression Region:1-200

Sequence Info:full length protein

View full details