
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P06886
Gene Names: tst
Organism: Staphylococcus aureus
AA Sequence: STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Expression Region: 41-234aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 37.9 kDa
Alternative Name(s): TSST-1
Relevance: Responsible for the symptoms of toxic shock syndrome.
Reference: "The nucleotide and partial amino acid sequence of toxic shock syndrome toxin-1."Blomster-Hautamaa D.A., Kreiswirth B.N., Kornblum J.S., Novick R.P., Schlievert P.M.J. Biol. Chem. 261:15783-15786(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1(tst)
- Regular price
- £639.00 GBP
- Sale price
- £639.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type C-1(entC1)
- Regular price
- £639.00 GBP
- Sale price
- £639.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type E(entE)
- Regular price
- £639.00 GBP
- Sale price
- £639.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type C-2(entC2)
- Regular price
- £639.00 GBP
- Sale price
- £639.00 GBP
- Regular price
-
- Unit price
- per
Sold out