Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1(tst)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1(tst)

CSB-EP361973FKZ
Regular price
£639.00 GBP
Sale price
£639.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P06886

Gene Names: tst

Organism: Staphylococcus aureus

AA Sequence: STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN

Expression Region: 41-234aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 37.9 kDa

Alternative Name(s): TSST-1

Relevance: Responsible for the symptoms of toxic shock syndrome.

Reference: "The nucleotide and partial amino acid sequence of toxic shock syndrome toxin-1."Blomster-Hautamaa D.A., Kreiswirth B.N., Kornblum J.S., Novick R.P., Schlievert P.M.J. Biol. Chem. 261:15783-15786(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1(tst)
    Regular price
    £639.00 GBP
    Sale price
    £639.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Enterotoxin type C-1(entC1)
    Regular price
    £639.00 GBP
    Sale price
    £639.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Enterotoxin type E(entE)
    Regular price
    £639.00 GBP
    Sale price
    £639.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Enterotoxin type C-2(entC2)
    Regular price
    £639.00 GBP
    Sale price
    £639.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share