
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cell Biology
Uniprot ID:P81297
Gene Names:sspP
Organism:Staphylococcus aureus
AA Sequence:YNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFEQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESRNGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY
Expression Region:215-388aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:27.4 kDa
Alternative Name(s):Staphopain A(EC 3.4.22.48)(Staphylococcal cysteine proteinase A)(Staphylopain A)
Relevance:Cysteine protease that plays an important role in the inhibition of host innate immune response. Cleaves host elastins found in connective tissues, pulmonary surfactant protein A in the lungs, and the chemokine receptor CXCR2 on leukocytes (PubMed:3422637, PubMed:23235402). Proteolytic cleavage of surfactant protein A impairs bacterial phagocytocis by neutrophils while CXCR2 degradation blocks neutrophil activation and chemotaxis (PubMed:3422637, PubMed:23235402). Additionally, promotes vascular leakage by activating the plasma kallikerin/kinin system, resulting in hypotension (PubMed:15897280).
Reference:"Staphylococcus aureus proteases degrade lung surfactant protein A potentially impairing innate immunity of the lung." Kantyka T., Pyrc K., Gruca M., Smagur J., Plaza K., Guzik K., Zeglen S., Ochman M., Potempa J. J. Innate Immun. 5:251-260(2013)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
You may also like
-
Recombinant Staphylococcus aureus Staphopain B(sspB)
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Staphopain B(sspB)
- Regular price
- £694.00 GBP
- Sale price
- £694.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Clumping factor B(clfB) ,partial
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Foldase protein PrsA(prsA)
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out