Gene Bio Systems
Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2(mnhE2)
Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2(mnhE2)
SKU:CSB-CF760523SKW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain MSSA476)
Uniprot NO.:Q6GBK3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR
Protein Names:Recommended name: Putative antiporter subunit mnhE2 Alternative name(s): Mrp complex subunit E2 Putative NADH-ubiquinone oxidoreductase subunit mnhE2
Gene Names:Name:mnhE2 Synonyms:mrpE2 Ordered Locus Names:SAS0593
Expression Region:1-160
Sequence Info:full length protein
