Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2(mnhc2)

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2(mnhc2)

SKU:CSB-CF641177FLF

Regular price £1,088.00 GBP
Regular price Sale price £1,088.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain NCTC 8325)

Uniprot NO.:Q2G213

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Protein Names:Recommended name: Putative antiporter subunit mnhC2 Alternative name(s): Mrp complex subunit C2 Putative NADH-ubiquinone oxidoreductase subunit mnhC2

Gene Names:Name:mnhc2 Synonyms:mrpC2 Ordered Locus Names:SAOUHSC_00627

Expression Region:1-114

Sequence Info:full length protein

View full details