Recombinant Staphylococcus aureus  Putative antiporter subunit mnhC2(mnhc2)

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2(mnhc2)

CSB-CF641064SKZ
Regular price
£870.00 GBP
Sale price
£870.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain USA300)

Uniprot NO.:Q2FJ13

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Protein Names:Recommended name: Putative antiporter subunit mnhC2 Alternative name(s): Mrp complex subunit C2 Putative NADH-ubiquinone oxidoreductase subunit mnhC2

Gene Names:Name:mnhc2 Synonyms:mrpC2 Ordered Locus Names:SAUSA300_0612

Expression Region:1-114

Sequence Info:full length protein

Your list is ready to share