Gene Bio Systems
Recombinant Staphylococcus aureus Protein translocase subunit SecG(SAOUHSC_00801)
Recombinant Staphylococcus aureus Protein translocase subunit SecG(SAOUHSC_00801)
SKU:CSB-CF643012FLF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain NCTC 8325)
Uniprot NO.:Q2G026
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIYYLSYIRNGGQFMHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQK QRGVDLFLNRLTIILSILFFVLMICISYLGM
Protein Names:Recommended name: Protein translocase subunit SecG
Gene Names:Ordered Locus Names:SAOUHSC_00801
Expression Region:1-91
Sequence Info:full length protein
