Gene Bio Systems
Recombinant Staphylococcus aureus Na(+)-H(+) antiporter subunit G1
Recombinant Staphylococcus aureus Na(+)-H(+) antiporter subunit G1
SKU:CSB-CF428293SUM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain USA300 / TCH1516)
Uniprot NO.:A8Z053
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL
Protein Names:Recommended name: Na(+)/H(+) antiporter subunit G1 Alternative name(s): Mnh complex subunit G1
Gene Names:Name:mnhG1 Ordered Locus Names:USA300HOU_0906
Expression Region:1-118
Sequence Info:full length protein