Gene Bio Systems
Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase(acpS)
Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase(acpS)
SKU:CSB-EP740005SKV
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q6GF02
Gene Names: acpS
Organism: Staphylococcus aureus (strain MRSA252)
AA Sequence: MIHGIGVDLIEIDRIKVLYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF
Expression Region: 1-119aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 29.6 kDa
Alternative Name(s): 4'-phosphopantetheinyl transferase AcpS
Relevance: Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.
Reference: "Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance." Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J., Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A., Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C., Clark L., Corton C. Parkhill J.Proc. Natl. Acad. Sci. U.S.A. 101:9786-9791(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
![Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase(acpS)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_d0a79622-20c6-44dd-b036-84022fc800b4.jpg?v=1659195638&width=1445)