Skip to product information
1 of 1

Gene Bio Systems

Recombinant Spodoptera frugiperda Cytochrome c oxidase subunit 3(COIII)

Recombinant Spodoptera frugiperda Cytochrome c oxidase subunit 3(COIII)

SKU:CSB-CF654282FKQ

Regular price £1,223.00 GBP
Regular price Sale price £1,223.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Spodoptera frugiperda (Fall armyworm)

Uniprot NO.:Q35826

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWPPTSITPFNPFQIPLLNTIILISSGVSVTWAHHAIMENNNSQMTQGLFITIILGIYFT ILQAYEYFEAPFTIADSIYGSTFFMATGFHGLHVIIGTLFLLICLIRHLNNHFSSNHHFG FEAAAWYWHFVDVVWLFLYISIYWWGN

Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide III

Gene Names:Name:COIII

Expression Region:1-147

Sequence Info:full length protein

View full details