Recombinant Spinacia oleracea Photosystem I reaction center subunit V, chloroplastic(PSAG)

SKU: CSB-CF320962FKI

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Spinacia oleracea (Spinach)

Uniprot NO.:P12357

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ELSPSLVISLSTGLSLFLGRFVFFNFQRENMAKQVPEQNGMSHFEAGDTRAKEYVSLLKS NDPVGFNIVDVLAWGSIGHIVAYYILATASNGYDPSFF

Protein Names:Recommended name: Photosystem I reaction center subunit V, chloroplastic Alternative name(s): PSI-G Photosystem I 9 kDa protein

Gene Names:Name:PSAG

Expression Region:70-167

Sequence Info:full length protein