Gene Bio Systems
Recombinant Spinacia oleracea Photosystem I reaction center subunit V, chloroplastic(PSAG)
Recombinant Spinacia oleracea Photosystem I reaction center subunit V, chloroplastic(PSAG)
SKU:CSB-CF320962FKI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Spinacia oleracea (Spinach)
Uniprot NO.:P12357
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ELSPSLVISLSTGLSLFLGRFVFFNFQRENMAKQVPEQNGMSHFEAGDTRAKEYVSLLKS NDPVGFNIVDVLAWGSIGHIVAYYILATASNGYDPSFF
Protein Names:Recommended name: Photosystem I reaction center subunit V, chloroplastic Alternative name(s): PSI-G Photosystem I 9 kDa protein
Gene Names:Name:PSAG
Expression Region:70-167
Sequence Info:full length protein
