Skip to product information
1 of 1

Gene Bio Systems

Recombinant Southern cowpea mosaic virus Polyprotein P2A(ORF2A)

Recombinant Southern cowpea mosaic virus Polyprotein P2A(ORF2A)

SKU:CSB-CF767760SIY

Regular price £1,183.00 GBP
Regular price Sale price £1,183.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea))

Uniprot NO.:Q83470

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SLFPPKPRATSSKPITTSSPGTPGRSPLPVSGKELGPSTQSSSKLSRKQRRRRSTKRPVQ GSPSPASPPPTRT

Protein Names:Recommended name: Polyprotein P2A Cleaved into the following 5 chains: 1. N-terminal protein 2. Serine protease EC= 3. 3.4.21.- 4. VPg 5. Putative protein p10 6. Putative protein p8

Gene Names:ORF Names:ORF2A

Expression Region:500-572

Sequence Info:full length protein

View full details