Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sinorhizobium medicae UPF0060 membrane protein Smed_0659 (Smed_0659)

Recombinant Sinorhizobium medicae UPF0060 membrane protein Smed_0659 (Smed_0659)

SKU:CSB-CF410193STV

Regular price £1,191.00 GBP
Regular price Sale price £1,191.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sinorhizobium medicae (strain WSM419) (Ensifer medicae)

Uniprot NO.:A6U785

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPAFAIYFLAALAEIAGCFTFWAWLRLGKSGLWLLPGMASLAIFAWLLTMVDTPAAGRAY AAYGGIYIIASLCWLWVAEGARPDRWDMTGAAVALAGSAIILAGPR

Protein Names:Recommended name: UPF0060 membrane protein Smed_0659

Gene Names:Ordered Locus Names:Smed_0659

Expression Region:1-106

Sequence Info:full length protein

View full details