Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shigella phage SfV Bactoprenol-linked glucose translocase(gtrA)

Recombinant Shigella phage SfV Bactoprenol-linked glucose translocase(gtrA)

SKU:CSB-CF519485SZE

Regular price £1,199.00 GBP
Regular price Sale price £1,199.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shigella phage SfV (Shigella flexneri bacteriophage V) (Bacteriophage SfV)

Uniprot NO.:O22008

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKLFVKYTSIGVLNTLIHWVVFGVCIYAAHTSQALANFTGFVVAVSFSFFANARFTFKA STTAMRYMLYVGFMGILSVIVGWAADKCSLPPIVTLITFSAISLVCGFVYSKFIVFRDAK

Protein Names:Recommended name: Bactoprenol-linked glucose translocase Alternative name(s): Flippase

Gene Names:Name:gtrA Synonyms:26

Expression Region:1-120

Sequence Info:full length protein

View full details