Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shewanella sp. Fumarate reductase subunit D(frdD)

Recombinant Shewanella sp. Fumarate reductase subunit D(frdD)

SKU:CSB-CF377477STT

Regular price £1,199.00 GBP
Regular price Sale price £1,199.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shewanella sp. (strain W3-18-1)

Uniprot NO.:A1REF8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MINYSPKRSDEPIWWGLFGAGGVWFAMITPVTVLLMGILLPLHGFGVVDIGYDKVYAFVS HPIGGAFTVLSLSLPMWHAMHRVHHGLHDLQIHLGTVGKYACYLAAALVTVLATVWVIQL S

Protein Names:Recommended name: Fumarate reductase subunit D

Gene Names:Name:frdD Ordered Locus Names:Sputw3181_0201

Expression Region:1-121

Sequence Info:full length protein

View full details