Recombinant Sheep T-cell surface glycoprotein CD3 delta chain(CD3D)

SKU: CSB-CF004930SH

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ovis aries (Sheep)

Uniprot NO.:P18438

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RALEVLEAEDKVILKCNSSITLLQGTAGQEVSDNKTLNLGKRIEDPRGMYQCGENAKSFTLQVYYRMCQNCVELDSATLAGLIITDIIATVLLALGVYCFAGHETGRFSRAADTQVLMGNDQLYQPLRERNDAQYSRLGDKWARNK

Protein Names:Recommended name: T-cell surface glycoprotein CD3 delta chain Alternative name(s): T-cell receptor T3 delta chain CD_antigen= CD3d

Gene Names:Name:CD3D

Expression Region:22-167

Sequence Info:full length protein