
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P36925
Gene Names: IL8
Organism: Ovis aries (Sheep)
AA Sequence: AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP
Expression Region: 23-101aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 13.1 kDa
Alternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8
Relevance: IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Reference: Sequencing of the ovine interleukin-8-encoding cDNA using the polymerase chain reaction.Legastelois I., Greenland T., Arnaud P., Mornex J.F., Cordier G.Gene 150:367-369(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Dog Interleukin-8(IL8)
- Regular price
- £877.00 GBP
- Sale price
- £877.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-8(CXCL8)
- Regular price
- £532.00 GBP
- Sale price
- £532.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-8(CXCL8)
- Regular price
- £532.00 GBP
- Sale price
- £532.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Dog Interleukin-8(IL8)
- Regular price
- £800.00 GBP
- Sale price
- £800.00 GBP
- Regular price
-
- Unit price
- per
Sold out