Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sclerotinia sclerotiorum Assembly factor cbp4(cbp4)

Recombinant Sclerotinia sclerotiorum Assembly factor cbp4(cbp4)

SKU:CSB-CF408196STG

Regular price £1,229.00 GBP
Regular price Sale price £1,229.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)

Uniprot NO.:A7EJE5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPPKPINWRMYSKMAVAGITCCVGGPALIYYISPTEEELFLKYNPELQKRSLENRVGKQE DFDNFVARLKEYSKSDRPIWVEAEEAARKNRSGKIEEQAKLMQEMQQRKEEIKKSGTKLM PGGSL

Protein Names:Recommended name: Assembly factor cbp4 Alternative name(s): Cytochrome b mRNA-processing protein 4

Gene Names:Name:cbp4 ORF Names:SS1G_05438

Expression Region:1-125

Sequence Info:full length protein

View full details