Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe UPF0618 protein C8C9.19(SPAC8C9.19)

Recombinant Schizosaccharomyces pombe UPF0618 protein C8C9.19(SPAC8C9.19)

SKU:CSB-CF687276SXV

Regular price £1,048.00 GBP
Regular price Sale price £1,048.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q4ZGE1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPNLRRIFASFRTEEEERSYSRKAFFHLIGYITCSVLFSWLVRKKVISSPVVSSPIHAL S

Protein Names:Recommended name: UPF0618 protein C8C9.19

Gene Names:ORF Names:SPAC8C9.19

Expression Region:1-61

Sequence Info:full length protein

View full details