Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Rsm22-cox11 tandem protein 2, mitochondrial(cos1102)

Recombinant Schizosaccharomyces pombe Rsm22-cox11 tandem protein 2, mitochondrial(cos1102)

SKU:CSB-CF768243SXV

Regular price £1,259.00 GBP
Regular price Sale price £1,259.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q86ZU7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TTIYYLVAISIFALGLTYAAVPLYRLFCSKTGYGGTLNTDQSRMNAERMVPRKDNKRIRV TFNGDVAGNLSWKLWPQQREIYVLPGETALGFYTAENTSDHDIVGVATYNIVPGQAAVYF SKVACFCFEEQKLDAHEKVDLPVFFFIDPEFADDPNMKDIDDILLSYTFFEARYDTNGNL LTKLN

Protein Names:Recommended name: Rsm22-cox11 tandem protein 2, mitochondrial Cleaved into the following 2 chains: 1. 37S ribosomal protein S22-2 EC= 2. 2.1.1.- 3. Cytochrome c oxidase assembly protein cox11-2

Gene Names:Name:cos1102 Synonyms:cox11, cox11-b ORF Names:SPAC19B12.13, SPAPB8E5.01

Expression Region:569-753

Sequence Info:full length protein

View full details