Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C1235.17 (SPCC1235.17)

Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C1235.17 (SPCC1235.17)

SKU:CSB-CF522305SXV

Regular price £1,224.00 GBP
Regular price Sale price £1,224.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:G2TRT7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGRCGTHTQINFLAGFVVRFNNVKTCLAQFWVNMGQNKEGNADKSSYFKVVSVILTLRGY VQLGYMVIHLVTHTLHCITLYITITHYTIYIVNIVIQLWLYRYIERFFYSLLVEYCENLC DSKEKRKVVIRFYFHFYFFFSFLFFIEKKK

Protein Names:Recommended name: Putative uncharacterized transmembrane protein C1235.17

Gene Names:ORF Names:SPCC1235.17

Expression Region:1-150

Sequence Info:full length protein

View full details