Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C576.19c(SPCC576.19c)

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C576.19c(SPCC576.19c)

SKU:CSB-CF871639SXV

Regular price £1,197.00 GBP
Regular price Sale price £1,197.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9C0V2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPTSSNDLYQTRLDVQTPNRWFLYISLELFNNMYSPFRSSSVLLSGAQSDIPKVGKCLFL PCRSLEFRASANSLSVHFLLNVISAILSMLIERYAVEVIMSKITWPRSNEDWRFHGIKG

Protein Names:Recommended name: Putative uncharacterized protein C576.19c

Gene Names:ORF Names:SPCC576.19c

Expression Region:1-119

Sequence Info:full length protein

View full details