Gene Bio Systems
Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.02 (SPCC622.02)
Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.02 (SPCC622.02)
SKU:CSB-CF527235SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:O94592
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAANISKLEAIIDNTPNSSPDPEVSHKLWVSSLNKFQYTLPLLISNFAGLGIAFIYCLIA FIREMSHPSSRKDTMEHGLPIILCSTLMLVGNILYYFLSKHPLKVTVPEDLVQIPMQQMS SPAQEAP
Protein Names:Recommended name: Putative uncharacterized membrane protein C622.02
Gene Names:ORF Names:SPCC622.02
Expression Region:1-127
Sequence Info:full length protein