Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Protein sym1(sym1)

Recombinant Schizosaccharomyces pombe Protein sym1(sym1)

SKU:CSB-CF521101SXV

Regular price £1,271.00 GBP
Regular price Sale price £1,271.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O14142

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSRFATRYNALFEKAPIMTMCLTAGTLGGISDAVAQGLTIYQTNKNAMIGLDGVRLNTH PEIPSIKRVLQFVTFGFAISPFQFRWLRLLSAKFPIEKGAINVVKRVLLDQAVFAPFGTA FFFSWMTLAEGKGFRGAYDKLQAVFWPTLKANYMVWPFFQTVNFWLMPLQYQMPFACTVA IFWNIFLSLKNASSMQESGSQEIELF

Protein Names:Recommended name: Protein sym1

Gene Names:Name:sym1 ORF Names:SPAC3G6.05

Expression Region:1-206

Sequence Info:full length protein

View full details