Gene Bio Systems
Recombinant Schizosaccharomyces pombe Cytochrome oxidase assembly protein 3, mitochondrial(tam3)
Recombinant Schizosaccharomyces pombe Cytochrome oxidase assembly protein 3, mitochondrial(tam3)
SKU:CSB-CF522294SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:G2TRJ9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNQGNQAFENARKPFRRANLITALGLGAFAFATFAYSVYRVHEDTFEDVVMTPELEKKIA EDRDLSKKN
Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial Alternative name(s): Transcripts altered in meiosis protein 3
Gene Names:Name:tam3 ORF Names:SPAC1B3.21
Expression Region:1-69
Sequence Info:full length protein
