Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces japonicus Probable endonuclease lcl3(lcl3)

Recombinant Schizosaccharomyces japonicus Probable endonuclease lcl3(lcl3)

SKU:CSB-CF469602SXT

Regular price £1,295.00 GBP
Regular price Sale price £1,295.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)

Uniprot NO.:B6JYT1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQNQRNEYSISLRNLSYIILTISTGIVIHRKFRRIKDIEDLSSRFFRGQQKSLTKLNSLY GYVTSVGDGDNFRFYHTPGGRLLGWHWLRKVPSNRNALKNETLSIRLSGIDAPESGYFGK LGQPFSLEAKQFLARKLEHRSVRVYPLHRDQYNRAVCGVTYYPIRWLFFKRDIGPQLVSR GLAVVYEGANSSYYPTEKSVLMKIQETARKRKLGMHSLGNKLELPKDYKKRNK

Protein Names:Recommended name: Probable endonuclease lcl3 EC= 3.1.-.-

Gene Names:Name:lcl3 ORF Names:SJAG_01749

Expression Region:1-233

Sequence Info:full length protein

View full details