Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces japonicus Altered inheritance of mitochondria protein 31, mitochondrial(aim31)

Recombinant Schizosaccharomyces japonicus Altered inheritance of mitochondria protein 31, mitochondrial(aim31)

SKU:CSB-CF474296SXT

Regular price £1,191.00 GBP
Regular price Sale price £1,191.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)

Uniprot NO.:B6K2Z6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKTSPVVPPIKLSEPTESGNDTTETSGRLKHLFRDQPLIPIGCAATVGAFLFATRAIRR GDSMRANRFFRYRVLAQAATVLAIVGGVFMERKMKQEKRMEQITPK

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:aim31 ORF Names:SJAG_02975

Expression Region:1-106

Sequence Info:full length protein

View full details