Skip to product information
1 of 1

Gene Bio Systems

Recombinant Scheffersomyces stipitis Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Recombinant Scheffersomyces stipitis Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

SKU:CSB-CF385312SXM

Regular price £1,209.00 GBP
Regular price Sale price £1,209.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)

Uniprot NO.:A3LVL1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVIRSKEQPVVPLGALATTGAIILAARSMKRGEKLRTQVYFRYRVVFQLITLVALVAGGV MMQQESAEQKKTREDKLREKAKQREKLWIEELERRDALIQERKRRLEESRAELKKMAEEG FKQENDNSKGK

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:AIM31 ORF Names:PICST_36309

Expression Region:1-131

Sequence Info:full length protein

View full details